|
|
Title: Bacteriocin-metal
complexes in the detection of pathogens and other biological analytes
United States Patent: 7,034,113
Issued: April 25, 2006
Inventors: Olstein; Alan D.
(Mendota Heights, MN); Feirtag; Joellen (St. Paul, MN)
Assignee: Paradigm
Diagnostics, LLC (Mendota Heights, MN)
Appl. No.: 082618
Filed: February 22, 2002
|
|
|
Pharm/Biotech Jobs
|
Abstract
Complexes of bacteriocins and metals are
provided that are useful in detecting bacteria, fungi and other biological
analytes, and are particularly useful in detecting gram positive bacteria.
The complexes are preferably chelated complexes wherein the bacteriocin is
a lantibiotic, non-lanthionine containing peptide, large heat labile
protein and complex bacteriocin, fusion protein thereof, mixture thereof,
and fragment, homolog and variant thereof, and (b) a detectable label
comprising a transition or lanthanide metal. The complex preferentially
binds to viable gram positive or mycobacterial cells. The complex can also
bind to gram negative bacteria and fungi. Methods of using the complexes
in assays, diagnosis and imaging are also provided.
DETAILED DESCRIPTION
OF THE INVENTION
The present invention provides novel
bacteriocin-metal chelated complexes constituting a new class of
chemiluminescent cell labels useful for rapid detection of gram positive
pathogens and mycobacteria. The bacteriocin-metal chelates also may be
used to detect non-bacterial pathogens. The invention further provides for
a method of the manufacture of these labels and a method for use in a
rapid detection assay for bacterial and non-bacterial pathogens.
A specific advantage of the present invention is the ability to detect
viable cells. The bacteriocins bind to and form pores in functioning
membranes. For example, the membrane-active channel-forming peptides of
the Nisin family utilize the membrane potential of the living bacterium to
bind and form a pore structure through the bacterial membrane. Thus, these
bacteriocin-metal chelates serve as vital stains, and indicate the
presence of viable bacteria.
It has been discovered that bacteriocins form a complex with redox-active
metals requiring minimal chemical modification, and yield chemiluminescent
bacteriocin-metal chelates. These bacteriocin-metal chelates appear to be
as catalytically active as the oxidative enzymes and organo-metallic
complexes of the porphyrins in catalyzing the hydrogen peroxide-mediated
oxidation of luminol. Most significantly, these chelates are fully
biologically active and are not sterically hindered by large enzymes or
conjugated organic groups.
The present invention relates to the use of these bacteriocin-metal
complexes as chemiluminescent probes for sensitive detection of bacterial
and non-bacterial pathogens. A detection sensitivity for potential
pathogens of 1 to 100 cells, preferably 5 to 20 cells, and most preferably
5 to 10 cells per sample. Contemporaneous assay of complex samples using
immuno-magnetic capture of bacteria coupled with chemiluminescent
detection can be performed. By coupling the immuno-magnetic capture
technique with sensitive chemiluminescent detection, the analysis time is
reduced from days to a few hours. In addition, the use of bacteriophage
coupled with magnetic capture techniques is also advantageous.
In addition, these chemiluminescent probes can be used to study the
biological affinity of bacteriocins to various organisms, particularly
differing species of bacteria. While not being held to any particular
theory, we hypothesize that there may be a correlation between bacteriocin
affinity/binding and the resistance of a particular species to the
bacteriocin. By correlating bacteriocin binding to pathogens using
standard Minimal Inhibitory Concentration techniques to our titration
data, a relationship between resistance and bacteriocin affinity may be
demonstrated. The chemiluminescent bacteriocin binding assay can be used
to examine the variables in bacteriocin resistance acquisition including,
time course, environmental influences and effects of microbial flora.
The chelated complexes of the present invention are comprised of (a) a
bacteriocin selected from the group consisting of lantibiotics, non-lanthionine
containing peptides, large heat labile proteins and complex bacteriocins,
fusion proteins thereof, mixtures thereof, and fragments, homologs and
variants thereof, and (b) a detectable label comprising a transition or
lanthanide metal.
II. Bacteriocins
Many organisms synthesize proteins or peptides which are degraded to
smaller bioactive peptides having hydrophobic or amphipathic properties.
For example, mammals synthesize defensins and cathelins, which provide
antimicrobial activity in the intestines or leukocytes, for example.
Various frog species synthesize magainins, dermnaseptins and bombinins, as
well as other cationic peptides. Insects produce cecropins, defensins,
apidaecins and diptericins, among others. The proteins and peptides in
each family within this functional superfamily are homologous, but they
exhibit little or no significant sequence similarity with members of the
other families. Often, the peptides are cationic, which appears to play a
role in their function of binding to and permeabilizing the membranes of
invading microbes. These peptides generally exhibit antibiotic,
fungicidal, virucidal, hemolytic or tumoricidal activities by interacting
with membranes and forming transmembrane channels that allow leakage
across cell membranes or bilayers.
Similarly, bacterial ribosomally synthesized antimicrobial polypeptides
are generally referred to as bacteriocins. The bacteriocins fall into the
following general categories:
Lantibiotics—post-translationally modified peptides, usually of less than
about 5 kDa, which contain unusual amino acids such as lanthionine, beta-methyllanthionine
and dehydrated residues. Modes of activity against target organisms range
from membrane binding and pore formation, causing leakage of target cell
membranes (class A), and specific inhibition of enzyme activity (class B).
Class A lantibiotics include, but are not limited to nisin, lacticin 481,
camocin U149, subtilin, epidermin, pep5, gallidermin, epilancin K7 and
lactocin S. Amino acid sequences of these lantibiotics are shown in Table
1 below. Examples of class B lantibiotics include mersacidin, actagardine,
cinnamycin and duramycin. The membrane binding and/or subsequent pore
formation of class A lantibiotics, as well as the cationic defense
peptides of non-bacterial origin, appears to be at least partially voltage
dependent, and thus indicates the presence of viable cells.
Non-Lanthionine containing peptides—unmodified peptides, usually of about
10 kDa or less further categorized as follows: (i) listeria-active
peptides, e.g., Pediocin PA-1, Sakacin A, Sakacin P, Leucocin A, Curvacin
A, Mesentericin Y105, Carnobacteriocin BM1 and B2, Enterocin A, and
Piscicolin 126; (ii) poration complexes consisting of two proteinaceous
peptides, e.g., Lactacin F, Lactococcin G, Plantaricin E/F, Plantaricin
J/K; (iii) thiol-activated peptides requiring reduced cysteine residues
for activity, e.g., Lactococcin B.
Large Heat-Labile Proteins—larger proteins, generally having a molecular
weight greater than 31 kDa, e.g., Helveticin V-1829.
Complex Bacteriocins—composed of a protein with one or more chemical
moieties which may be of a lipid or carbohydrate nature, e.g., Pediocin
SJ-1. For additional details, see Nissen-Meyer, J., et al., Arch.
Microbiol. (1997) 167 (2/3): 67-77, and Sahl, H.-G., et al., (1998) Ann.
Rev. Microbiol. 52:41-79.
The bacteriocins are bacterially produced peptide antibiotics with the
ability to kill competing species bacteria, usually but not always those
that are closely related to the producer bacterium. Many of the
bacteriocins exhibit structural features typical of members of the
eukaryotic channel-forming amphipathic peptides. They are usually
synthesized as small precursor proteins or peptides that are processed by
proteolytic elimination of the N-terminal leader sequences. The resulting
mature peptides form one, two or more putative amphipathic transmembrane
spanning portions. Where two membrane spanning portions are present, a
characteristic hinge region that separates the two putative transmembrane
segments is usually observed. A similar structural arrangement is observed
in the Cecropin A proteins, having two transmembrane segments.
| TABLE 1 |
| |
| CLASS A LANTIBIOTICS |
|
| Name |
Example |
Amino Acid Sequence |
| |
| Gallidermin |
Gallidermin |
MEAVKEKNELFDLDVKVNAKESNDSGAE |
(SEQ ID NO:1) |
|
| precursor |
precursor of |
PRIASKFLCTPGCAKTGSFNSYCC |
| |
Staphylococcus |
| |
gaiinarum |
| |
| Pep5 |
Pep5 lantibiotic |
MKNNKNLFDLEIRKETSQNTDELEPQTA |
(SEQ ID NO:2) |
| |
of |
GPAIRASVKQCQKTLKATRLFTVSCKGKNGCK |
| |
Staphylococcus |
| |
epidermidis |
| |
| Mutacin |
Mutacin of |
FKSWSFCTPGCAKTGSFNSYCC |
(SEQ ID NO:3) |
| BNY266 |
Streptococcus |
| |
mutans |
| |
| Subtilin |
Subtilin of |
MSKFDDFDLDVVKVSKQDSKITPQWKSES |
(SEQ ID NO:4) |
| precursor |
Bacillus subtilis |
LCTPGCVTGALQTCFLQTLTCNCKISK |
| |
| Nisin |
Nisin precursor |
MSTKDFNLDLVSVSKKDSGASPRITSISLC |
(SEQ ID NO:5) |
| precursor |
of
Lactococcus |
TPGCKTGALMGCNMKTATCHCSIHVSK |
| |
lactis |
| |
| Epidermin |
Epidermin of |
MEAVKEKNDLFNLDVKVNAKESNDSGAEP |
(SEQ ID NO:6) |
| precursor |
Staphylococcus |
RIASKFICTPGCAKTGSFNSYCC |
| |
epidermidis |
| |
| Epilancin K7 |
Epilancin K7 of |
MNNSLFDLNLNKGVETQKSDLSPQSASVL |
(SEQ ID NO:7) |
| precursor |
Staphylococcus |
KTSIKVSKKYCKGVTLTCGCNITGGK |
| |
epidermidis |
| |
A. Lantibiotics
Lantibiotics are small membrane-active channel-forming peptides having a
molecular weight less than about 5 kDa. The lantibiotics form a useful
group of bacteriocin-metal complexes suitable as catalytically active
chemiluminescent agents, and include nisin and related peptide
antibiotics, illustrated in FIG. 1. The nisin family belongs to a family
of defense peptides containing the unusual post-translational thioether
modification, lanthionine and beta methyl-lanthionine, called lantibiotics.
Lanthionine is a residue formed by post-translational processing, which is
two alanine residues bonded to sulfur at the beta carbonyls (13). The
peptides are produced by cytoplasmic dehydration of the hydroxy-amino
acids followed by Michael addition of the SH groups of cysteine residues
in the peptide to the vinyl groups formed. The thioether amino acids
formed by these concerted reactions are termed lanthionine or beta-methyl-lanthionine.
Certain of the lantibiotics and other bacteriocins work by forming
self-assembling aggregate pores in the cytoplasmic membranes of
susceptible bacteria. Binding of the bacteriocin to the membrane leads to
aggregation and oligomerization of bacteriocins, which then adopt a
transmembrane orientation so that the hydrophobic portion is exposed to
the core of the membrane and the hydrophilic part forms the aqueous
channel, as shown in FIG. 2. The pores impose a loss of vital salts,
cofactors and other materials necessary for cellular respiration and
metabolism. The remarkable utility of these agents as diagnostics resides
in their functional activity only toward viable bacteria. Cells which lose
their transmembrane electrical potential do not support the self-assembly
function of the antibiotic, as both membrane insertion and pore formation
require a transmembrane potential.
While wishing not to be bound by theory, it is hypothesized that the
thioether groups of the unusual amino acids and the amino groups provided
by lysine residues of the lantibiotics provide ligands for chelating
transition and lanthanide metals. The lantibiotics also form cyclic
structures, which allows for the creation of many hairpin turns in these
peptides, and is associated with binding transition metals and lanthanide
metals.
While lantibiotics are the preferred bacteriocins, any of the generally
cationic peptides synthesized by bacteria, plants, mammals or insects
having antimicrobial activity and forming complexes with transition or
lanthanide metals could be used. Therefore, diverse species of cationic
membrane active peptides such as the non-lanthionine containing
bacteriocins, defensins, cecropins, and magainins, for example, are
equally useful to generate metal complexes which bind to the membranes of
pathogens, and can be used for the detection of pathogenic species. Fusion
proteins, fragments, homologs and variants of these cationic peptides also
are encompassed within the present invention, so long as membrane binding
activity is preserved. However, the function of pore formation is not
necessary for detection, and therefore, the bacteriocins or other cationic
antimicrobial peptides, fusion proteins thereof, fragments, homologs and
variants thereof are included even if the pore forming activity has been
lost due to changes in amino acid sequence or secondary structure.
Preferably, the present invention is applicable to any bacteriocin capable
of binding to gram positive bacteria, mycobacteria, gram negative
bacteria, and fungi. Gram positive bacteria are preferred targets for the
bacteriocin-metal complexes of the present invention. In certain
embodiments, permeabilized gram negative bacteria and fungi may be
targeted.
Lactobacillus lactis subspecies can produce diplococcin,
lactococcin, lactostrepcins or nisin. Diplococcin and lactococcins are
small molecular weight proteins, active against other lactococci
while nisin is a lantibiotic with a broad spectrum of activity against
many Gram positive bacteria.
Nisin is the most extensively characterized bacteriocin of the
antimicrobial proteins produced by lactic acid bacteria and has found
widespread application in the food industry. Nisin was the first "lantibiotic"
compound to be used on a commercial scale in the food industry. It is used
to prevent spore outgrowth and toxin production by Clostridium
botulinum in processed cheese and cheese spreads. In some countries,
it has been used to extend the shelf-life of dairy products and to prevent
the spoilage of canned foods by thermophiles.
Nisin is a pentacyclic, class A lantibiotic and displays an amphiphathic
character, with a hydrophobic residue (Ile) at its N-terminus and a
hydrophilic residue (Lys) at its C-terminus. It is a peptide of 34 amino
acids and contains one lanthionine residue, four beta-methyllanthionines,
a dehydroalanine and a dehydrobutyrine. The thioether amino acids, (lanthionine
and beta-methyllanthionine) account for the high sulphur content of nisin.
The usual amino acid residues are thought to be responsible for the
important functional properties of nisin, e.g., the associated acid
tolerance and thermostable properties of nisin are attributed to the
stable thioether linkages while the specific bactericidal activity is
thought to be due to the very reactive double bonds. Nisin has a molecular
mass of 3.5 kDa and often forms dimers and oligomers.
As reviewed by Sahl et al., (Ann. Rev. Microbiol. (1998) Vol. 52,
pages 41-79), the lantibiotics comprise several classes of compounds, as
indicated by various mechanisms of action. For example, nisin and related
peptides (type A) appear to be bacteriocidal by virtue of their pore
forming ability, while type B lantibiotics appear to exert their activity
through interfering with enzyme activity by blocking the respective
substrate. For example, Mersacidin, a type B lantibiotic, binds to lipid
II.
An especially preferred lantibiotic for use in a bacteriocin-metal complex
is nisin. We have discovered that nisin chelates transition metals such
cobalt and iron without compromising its cellular binding function. Cobalt
chelates of nisin can be easily prepared by dissolving nisin in aqueous
solution and treating the solution with a cobalt salt to form the chelate.
Furthermore these chelates are also active in the hydrogen peroxide-driven
oxidation of luminol.
Exemplary members of the nisin family include nisin, mutacin, subtilin,
gallidermin, Pep5, epicidin 280, epilancin K7, lactocin S, streptococcin
A-FF22, lacticin 481, salivaricin A, variacin, cypemycin, mersacidin,
cinnamycin, duramycin and ancovenin, actagardine, sublancin, plantaricin
C, fusion proteins thereof, mixtures thereof and fragments, homologs and
variants thereof. It is intended that all similar lantibiotic structures
also be encompassed within this invention. For example, a truncated form
of one of the above listed lantibiotics may function adequately to bind to
viable bacteria, and may likewise form the antibiotic-metal chelate and
act as a chemiluminescent probe of the present invention. Similarly, a
mutant having a slightly different amino acid sequence may also function
adequately, and thus is included within the invention as described herein.
A wide variety of nisin and related lantibiotic mutants and variants have
been studied. Studies have shown that the Dhb residues in the central
portion of Pep5 appear to stabilize the three-dimensional conformation of
this peptide. If Ala is substituted for Dhb, the antibacterial activity is
lost. Subtilin may be made more stable by substituting Glu4 for Ile.
Similarly, nisin has been engineered to be more stable, (Dha5Dhb nisinZ),
or more soluble (N27K nisin Z, H31K nisin Z). Gallidermin may be made more
stable to trypsin (Dhb14Por A21L) and Pep5 may be made more stable to
chymotrypsin (A19C Pep5). T2S nisin Z, L6V gallidermin and M17Q/G18T nisin
Z show an enhanced antibacterial activity with at least some strains.
Therefore, it is clear that variations in the amino acid sequences and
post-translational processing of nisin and related peptides are possible.
All such variations resulting in active metal chelates that bind to target
bacteria or other pathogens are considered to be encompassed within the
present application.
Nucleotide sequences for the above lantibiotics are also well known in the
art. For example, the nucleotide sequence which encodes the amino acid
sequence for nisin from Streptococcus lactis is as follows:
| 1 |
agttgacgaa tatttaataa ttttattaat
atcttgattt tctagttcct gaataatata |
|
| |
| 61 |
gagataggtt tattgagtct tagacatact
tgaatgacct agtcttataa ctatactgac |
| |
| 121 |
aatagaaaca ttaacaaatc taaaacagtc
ttaattctat cttgagaaag tattggtaat |
| |
| 181 |
aatattattg tcgataacgc gagcataata
aacggctctg attaaattct gaagtttgtt |
| |
| 241 |
agatacaatg atttcgttcg aaggaactac
aaaataaatt ataaggaggc actcaaaatg |
| |
| 301 |
agtacaaaag attttaactt ggatttggta
tctgtttcga agaaagattc aqgtgcatca |
| |
| 361 |
ccacgcatta caagtatttc gctatqtaca
cccggttgta aaacaggagc tctgatgggt |
| |
| 421 |
tgtaacatga aaacagcaac ttgtcattgt
agtattcacg taagcaaata accaaatcaa |
| |
| 481 |
aggatagtat tttgttagtt cagacatgga
tactatccta tttttataag ttatttaggg |
| |
| 541 |
ttgctaaata gcttataaaa ataaagagag
gaaaaaacat gataaaaagt tcatttaaaq |
| |
| 601 |
ctcaaccqtt tttagtaaga aatacaattt
tatctccaaa cgataaacgg agttttactg |
| |
| 661 |
aatatactca agtcattgag actgtaagta
aaaataaagt ttttttggaa cagttactac |
| |
| 721 |
tagctaatcc taaactctat gatgttatgc
agaaatataa tgctggt |
Therefore, also included within the present bacteriocin-metal complexes
are amino acid sequences encoded by SEQ ID NO:8 as well as nucleic acid
sequences which hybridize with SEQ ID NO:8 under stringent conditions.
Amino acid sequences comprising the amino acid sequence of SEQ ID NOS:1-7,
having substitutions, insertions, deletions and additions of one, two,
three or more amino acids would also be within the scope of the present
invention.
Enzymatically or chemically derived fragments of these bacteriocins are
also encompassed by the invention. Mutations, truncations, homologs and
natural variants likewise are included within the scope of the invention.
Engineered variants such as fusion proteins or constructs comprising the
amino acid sequence of one or more bacteriocins may also be utilized in
the present invention. A particularly preferred embodiment is a fusion
protein comprising multiple copies of a bacteriocin. A preferred
bacteriocin for constructing a multimer of bacteriocins is nisin. In some
instances, the fusion construct is a multimer of one particular
bacteriocin. In other instances, the fusion construct is a multimer of
different bacteriocins. Spacer sequences comprising an amino acid sequence
of between about 5 to about 25 amino acids, preferably between about 1 to
about 10 amino acids, may be included between the C-terminus of one
subunit of bacteriocin and the N-terminus of the next bacteriocin. Any of
the above variations in bacteriocin structures may be used as probes
providing that the bacteriocin variant forms a chelated complex with the
metal, and the bacteriocin-metal complex binds to pathogen, particularly
gram positive bacteria and mycobacteria. In some instances, the pathogen
is a gram negative bacterium, or fungi. Non-pathogenic organisms may also
be targeted and detected if this is desired, provided that the bacteriocin
binds to the non-pathogenic target organism.
Fusion proteins comprising the amino acid sequences shown above as well as
those encoded by nucleic acid sequences comprising SEQ ID NO:8 are also
included in the present bacteriocin-metal complexes, as are multimers
comprised of one or more repeats of the nisin amino acid sequence shown
above (SEQ ID NO:5), preferably with the leader sequence removed. An
advantage of fusion constructs comprising bacteriocin sequences is that
additional metals will be present in the complex, and higher catalytic
efficiencies can be achieved, resulting in even greater sensitivity of
detection.
Non-lantibiotic bacteriocins, such as plantaricin, thermophilin and
mesentericin Y are also useful bacteriocins and may be used to generate
metal complexes and used to detect pathogens or other analytes. Any of the
ribosomally synthesized cationic defense proteins that bind to the
cytoplasmic membranes of target bacteria or other pathogens are included
within the present claims.
III. Target Pathogenic Species
The complexes of the present invention preferentially bind to gram
positive cells. In certain preferred embodiments of the invention, the
complexes are capable of binding to mycobacterial cells. In particular
embodiments, the bacterial cells are pneumococci, streptococci,
staphylococci, aerobic bacilli, lactobacilli, enterococci, anaerobic
clostridia, leuconostocs, micrococci, pediococci, actinomyces, listeria
and nocardia. In other embodiments, the bacterial cells are mycobacterium
tuberculosis, mycobacterium avium, mycobacterium
paratuberculosis, mycobacterium bovis and mycobacterium
leprae.
The complexes of the present invention are also capable of binding to and
detecting permeabilized gram negative bacterial cells. The outer membrane
of gram negative bacteria excludes substances such as bacteriocins, thus
preventing the bacteriocin from making contact with the cytoplasmic
membrane. The gram negative bacterial cells may be permeabilized by
treating the cells with a chelating agent (e.g., EDTA) such that the
structure of the outer membrane undergoes alteration, resulting in
destabilization of the lipopolysaccharide (LPS) layer with a corresponding
increase in cell permeability. Another method of permeabilizing gram
negative cells is by pre-treating the cells with the non-toxic fragment of
polymyxin B, polymyxin B nonapeptide, which renders gram-negative bacteria
susceptible to substances known to be unable to pass through the outer
membrane envelope. These permeabilization methods do not kill the bacteria
and so are a useful method of rendering the gram negative bacterial cell
membrane susceptible to detection using the bacteriocin-metal complexes
described herein.
Permeabilized gram negative bacteria that may be targeted by the present
bacteriocin metal chelates include, but are not limited to, neisseria,
Flavobacter and salmonella, as well as Enterobacteriace
and all other classes of aerobic and anaerobic gram negative
microorganisms, that have been permeabilized such that the bacteriocin-metal
complexes of the present invention are permitted access to the cell
membrane.
When the bacteriocin-metal complex comprises nisin, a very broad spectrum
of activity against gram-positive vegetative bacterial cells is observed.
The closely related lactococci are especially preferred but nisin-metal
complexes are also active against several strains of bacilli and
clostridia, lactobacilli, leuconostocs, micrococci, pediococci,
streptococci and actinomycetes. Other detectable strains include
Mycobacterium tuberculosis, Staphylococcus pyogenes, S. aureus, S.
epidermidis and Listeria monocytogenes (de Vuyst & Vandamme,
1994). Certain gram negative strains such as Neisseria (Mattick &
Hirsch, 1947) and Flavobacter (Ogden & Tubb, 1985) may also be
targeted. Salmonella subspecies and other gram negative bacteria
can be detected using bacteriocin-metal complexes comprising nisin
provided that the bacteria are permeabilized.
Under normal circumstances, nisin does not inhibit yeasts or viruses.
However, the bacteriocin-metal complexes are capable of binding to fungal
membranes in the presence of an agent that inhibits the biogenesis of a
normal fungal cell wall, or in the presence of a cell wall lytic enzyme.
Thus, the bacteriocin-metal complexes are also active against fungal
membranes, and may be used to target fungal infection or contamination. In
particular, the bacteriocin-metal complexes may by used in the detection
and diagnosis of fungal diseases, for example cryptocossis, histoplasmosis,
blastomycosis, coccidioidomysis, sporotrichosis, chromoblastomycosis,
aspergillosis, zygomycosis, and candidiasis. Candidiasis is a preferred
target for detection and diagnosis. Inhibition of the biogenesis of a
normal fungal cell wall can be effected, for example by providing agents
that inhibit the anchorage of cell wall proteins into the cell wall of the
fungi, beta-(1,6)-glucose polysaccharides or branched polysaccharides
having a beta-(1,6)-glucose-backbone, such as beta-gentiobiose and
pustulan fragments, and mixtures thereof.
Alternatively, fungi may also be targeted by the bacteriocin-metal chelate
when the fungi have been treated with a cell wall lytic enzyme, such as
chitinase or a glucanase, or, more preferably, a mixture of them. The
preferred glucanase is beta-1,3-glucanase, optionally admixed with
beta-1,6-glucanase. The enzyme(s) can be used as a separate, more or less
pure enzyme isolate, but combinations of the enzymes are preferred. Crude
preparations from natural origin containing the enzymes are commercially
available and can be used instead of purified enzymes. One such enzyme
preparation is marketed as NovoZyme™ 234, ex NOVO, Denmark, which is a
mixture of lytic enzymes containing, inter alia, chitinase as well as
beta-1,3-glucanase and small amounts of beta-1,6-glucanase. Such a
preparation is produced by fermentation of the fungus Trichoderma
harzianum according to U.S. Pat. No. 4,353,891, and described in WO
90/03732. Other natural mixtures of chitinase and said glucanases can be
obtained from vegetable sources, particularly from plants which are able
to produce glucanase and chitinase as described in e.g. Plant Physiology
101: pp 857-863. Chitinase as well as glucanase are preferably used in a
concentration of 0.001-2 wt. % calculated on the composition. The amount
of bacteriocin, preferably nisin, is 0.00001-0.1 wt. %, preferably
0.0001-0.02 wt. % calculated on the composition. The preferred ratio of
chitinase and beta-1,3-glucanase is 1:9 to 9:1. Concentrations and ratios
may be easily optimized depending on the actual composition ingredients.
IV. Metals of the Bacteriocin-Metal Complex
Co-pending U.S. patent application Ser. No. 09/687,990, filed Oct. 13,
2000, discloses that antibiotics of the polymyxin and colistin type
tightly bind a range of metals in aqueous solution. It has been further
discovered that bacteriocins will spontaneously chelate metals in aqueous
solution, and that these bacteriocin-metal complexes bind to viable cells,
but not to dead cells.
The preferred metals of the present invention include the transition
metals and the lanthanides. The transition metals are particularly
preferred because of their high oxidation-reduction activity in neutral
aqueous media. It is likely that these metals catalyze the process of
oxidizing chemiluminescent substrates, such as luminol by hydrogen
peroxide (Rost et al. (1998) J. Biolumin. Chemilumin. 13:355-363).
The bacteriocin-metal complexes can directly catalyze peroxide-driven
chemiluminescent reactions (for example, reactions involving luminol, its
aromatic derivatives, lucigenin, penicillin, luciferin and other
polyaromatic phthalylhydrazides) without the use of an enzyme catalyst
such as horseradish peroxidase or microperoxidase.
Factors influencing the catalytic efficiency of individual metals include
pH, ionic strength and oxidation state. Chelation chemistries that would
alter the oxidation state or steric availability of the metals during
catalysis could also influence the optimum catalytic activity as sensed by
the time dependent emission of photons. The transition metals, cobalt,
copper and chromium are preferred metal complexes because of their
inherently high catalytic efficiency for the peroxide-driven oxidation of
luminol (10). There may be other redox-active metals which could be as
efficient or more than the aforementioned metals.
Preferably, although not necessarily, the metal in the complex is a
transition metal or a lanthanide metal; more preferably it is copper,
cobalt, iron, manganese, chromium, nickel, zinc, terbium, gadolinium,
europium, or technicium. The metal is generally provided as an aqueous
soluble salt and at an oxidation state of +2 or +1.
Preferred transition metals measured in the bacteriocin-metal complex of
the present include iron (Fe), copper (Cu), cobalt (Co), chromium (Cr),
nickel (Ni), manganese (Mn), zinc (Zn) and technicium (Tc). The most
preferred metals, iron, cobalt, manganese and chromium, yield the most
catalytically active complexes on a molar basis. Cobalt and chromium
complexes are especially preferred.
Another preferred class of metal chelates of the present invention
comprise heavy metals in the lanthanide series, gadolinium (Gd), lanthanum
(La), europium (Eu), terbium (Tb), dysprosium (Dy), lutetium (Lu) and
erbium (Er).
A unique and useful aspect of terbium and europium complexes is that
neither the metal salts nor the antibiotic are fluorescent; however, some
of the chelates are fluorescent. For example, upon addition of the
lanthanide salts, terbium or europium chloride, to solutions of polymyxin,
a blue fluorescent emission can be observed at 400-450 nm when illuminated
with 330 nm light. The polymyxin B-terbium complex is also useful as an
epifluorescence microscopy label for E. coli and Salmonella
cells. Similarly, these lanthanide metals form fluorescent complexes with
the bacteriocins, preferably nisin.
Many of these bacteriocin-metal complexes have optical properties, e.g.
fluorescence, UV or visible light absorption. For example, polymyxin
B-metal complexes of terbium and europium are fluorescent and provide a
visible emission in the blue band when excited with 350 nm light;
polymyxin B-metal complexes of iron and cobalt are colored and can readily
be followed by spectrophotometry using techniques known to those of
ordinary skill in the art and described in the pertinent texts and
literature. Thus, the polymyxin-metal complex can be readily purified
using standard chromatographic techniques such as gel filtration or
dialysis procedures because it can be followed visually with either
visible absorbance or fluorescence depending on the type of complex.
Similarly, the bacteriocin metal chelates of the present invention are
readily formed and purified.
The binding interaction between the bacteriocin and metal is sufficiently
tight to permit isolation of the bacteriocin complex by gel filtration or
dialysis, which would ordinarily separate high molecular weight compounds
from simple metal salts. The strong absorbance bands exhibited by the
bacteriocin-metal complex permit the absorbance of the peptide chromophore
at 270 nm and the visible absorbance bands at 400 nm to be used to follow
purification of the complex. The efficient chelation of metals is
presumably due to formation of a cleft within the structure of the
bacteriocin, providing both carbonyl oxygens and amide nitrogens to
contribute electron density for orbital overlap in the outer electron
orbitals of a metal atom. While not wishing to be bound to any particular
theory, it is hypothesized that many species of bacteriocins are capable
of forming the chelated complex of the present invention, and being
capable of binding to viable microbial cells. Hairpin structures in
peptides also lend themselves to forming metal complexes. The lantibiotics
may also form complexes with metals via the thioether moieties that can
act as ligands for metals. Certain of the bacteriocins, the lantibiotics
in particular, are strongly cationic and may form complexes via their
amino groups.
The bacteriocin-metal chelate is preferably a chelated metal complex
containing one metal atom. The metal may be coordinated at four, five or
six sites. Preferably, the metal binding site is within the cleft formed
by the cyclized amino acids or other three dimensional structure formed by
the bacteriocin. A preferred bacteriocin is one that forms a molecular
cleft and retains bacterial binding activity, particularly with respect to
viable bacteria.
Optionally, addition of metal chelating ligands is possible with these
bacteriocins. Reductive alkylation with aromatic carboxaldehydes, the
monocarboxaldehyde of 2,2′-dipyridine, salicylaldehyde or
protocatechualdehyde, for example, would add a suitable metal binding
cavity to the bacteriocin molecule to chelate several transition metals
such as copper, nickel, zinc, technetium, and preferably cobalt, iron,
manganese, or chromium. The aforementioned ligands, including
2,2-dipyridyl monocarboxlic acid, salicylic acid, and protocatechuic acid,
could alternatively be grafted onto the bacteriocin through an amide
linkage as preformed, isolated N-hydroxysuccinimide esters. The ligands
could either be used pre-loaded with the metals as reactive chelates, or
optionally, chelated after the conjugates are formed.
V. Pathogen Capture
Pathogens present on or in the sample may be removed from the sample to be
tested by washing or other physical methods for sample preparation. For
example, the sample may be contacted using a swab and any organisms
present on the swab can be suspended into aqueous buffer solution. The
pathogens on the surface or within the sample may also be washed off using
buffer, disrupting the structure of the sample if necessary, by mincing or
shredding the sample, for example. Alternatively, the pathogens may be
disassociated from the sample by sonicating the sample in buffer. Buffer
solutions containing high salt, low or high pH, or additional solvents may
also be used to disassociate the pathogens from the sample to be tested.
In a preferred method, the sample may be treated first with the
bacteriocin and metal such that any pathogens present become labeled with
the bacteriocin-metal complex. Such in situ labeling can be performed
prior to the removal of pathogens from the sample. Alternatively, once the
pathogens are removed from the sample, the pathogens may be labeled with
the bacteriocin-metal complex.
The pathogens isolated from the sample may be concentrated by
centrifugation, filtration or drying. Alternatively, adsorptive particles
(e.g. magnetic immuno-microbeads or phage-microbeads) may be used to
concentrate the sample containing pathogens. Microbeads are beads
consisting of polystyrene or other synthetic latex, polymer coated ferrite
or super-paramagnetic materials, silica micro-beads or cross-linked
polysaccharide micro-beads, for example. Preferred microbeads are
non-porous monodisperse superparamagnetic particles comprising polystyrene
and divinyl benzene with a magnetite core (8±2×10-3 cgs units)
and a diameter of about 2-5 μm. Microbeads with reactive groups on their
surfaces (e.g., SH, OH, NH2, COOH, tosyl, etc.) are
commercially available. These microbeads can be used for covalent
attachment of proteins or nucleic acid ligands, but there is no limit to
substances that can be attached to the microbeads. For example, beads
which have streptavidin attached can be used to bind a component from a
sample that is attached to biotin.
Similarly, antibodies or antibody fragments (e.g., Fab) specific for one
or more target pathogens can be attached to magnetic microbeads via the
reactive groups in order to facilitate isolation and concentration of the
pathogen for quantitative or qualitative testing. The target pathogen can
be isolated using specific antibodies attached to microbeads and the
bacteriocin-metal complex is allowed to bind to the pathogen either before
or after isolation of the pathogen. For example, rapid capture of
Listeria cells in a complex sample can be effected using anti-Listeria
antibody on magnetic microbeads. Use of this immuno-microbead method
requires obtaining or preparing antibodies specific for Listeria
and attaching them to the reactive groups on the microbeads. Antibodies
with a broader range of specificities to target pathogens (e.g.,
antibodies that bind to peptidoglycan or lipopolysaccharide) can also be
attached to microbeads, and bacteriocin-metal complexes of more or less
desired specificity can be used as a probe for particular species.
A preferred method of isolating target bacterial pathogens is using
microbeads having attached bacteriophage, phage ghosts or purified phage
sheath proteins. The selective binding function of the phage or purified
phage sheath proteins is preferable to using antibodies because phage for
particular target species are readily available and can be very specific.
A bactreriophage specific for Listeria could be attached to
microbeads. For example, B1 Phage of Listeria monocytogenes (ATCC
23074), is commercially available, and when attached to microbeads, can be
used as a Listeria specific reagent. One could also inactivate
purified phage particles using hypo-osmotic shock, rapidly dilution into
distilled water, or by brief exposure to low pH, causing the loss of phage
DNA. The phage "ghosts" are then immobilized on activated magnetic
particles (e.g. tosyl-activated particles) in much the same manner as
antibodies are immobilized.
In another embodiment, the phage sheath protein carrying the recognition
site for Listeria cell walls is purified from intact phage
particles and attached to microbeads. The Phage sheath protein can also be
genetically engineered as a fusion peptide comprising a nickel-binding
site to permit affinity purification from crude E. coli lysates
once cloned into the appropriate expression vector. A similar approach
preparing fusion proteins containing the endolysin protein is described in
Loessner, M. et al. Modified Listeria Bacteriophage Lysin Genes (ply)
Allow Efficient Overexpression and One-Step Purification of
Biochemically Active Fusion Proteins. Appl. and Environm. Microbiol.
62, 3057-3060 (1996). Using either purified phage sheath protein, phage
ghosts, or fusion proteins comprising the sequence for phage sheath
protein, the phage is then attached to microbeads and used as a
Listeria specific capture agent. The bacterial pathogen, in this
example Listeria, can be treated with the bacteriocin-metal complex
either before isolation or after isolation from the sample being tested.
Detection and quantitation is effected in both cases by the
chemiluminescence of the bacteriocin-metal complex in the presence of an
oxidizable substrate and a source of peroxide.
Similarly, bacteriophages specific for other organisms can be used as
pathogen specific reagents for isolating the pathogens for ease of
quantitative and qualitative analysis. For example, Staphylococcus
aureus (subsp. aureus Rosenbach) is specifically targeted using
bacteriophage P1 (ATCC 11987). The range of bacteriophages available and
the bacteria for which they are specific will be realized to be vast by
those skilled in the art. For example a list of phage types is available
from the American Type Culture Collection (ATCC). Other such depositories
also publish equivalent data in their catalogues and this may be used to
identify possible phage "reagents" for the present method. Phages may be
used, inter alia, in aqueous suspension or in freeze dried form e.g. on
microtiter plate wells. In this manner plate luminometry can be used.
In addition to phages deposited with a depository, an additional source of
phages is provided by isolating them from suitable environments, such as
the environment where the target bacteria are themselves to be found. For
example, it is possible to isolate phages specific to both
Campylobacter spp. and Salmonella spp. from effluent from a
poultry processing plant. Isolation techniques will be well known to those
skilled in the art and are exemplified, for example, by Loessner and Busse
(1990) Appl. and Environm. Microbiol. Vol 56, pp 1912-1918, and Adams "Bacteriophages"
Pub Interscience Inc (1959) pp 447-455. Isolation of additional
bacteriophages that can be used in the present methods is described in
U.S. Pat. No. 6,322,783.
The range of media available for selective promotion of growth of a
particular bacterial type will also be known to those skilled in the art
and these may function by positive action or by e.g. inhibition of other
organisms. Examples of such media are illustrated by reference to
supplier's manuals, e.g. such as those available from UNIPATH Limited,
Wade Road, basingstoke, HANTS, RG24 OPW, UK "Selective Microbiology for
Food and Dairy Laboratories", or e.g. the OXOID manual. These publications
list, for example, media capable of favoring growth of Campylobacter,
Listeria and Yersinia. Similarly methods for isolation of food
pathogens for preparation of test samples are well known. (UNIPATH and
OXOID are Registered Trade Marks). Additional useful references are the
microbiology manuals: Bergey's Manual of Systematic Bacterial
Classification and the DIFCO manual.
Numerous methods are known in the art for covalently attaching chemical
moieties to surfaces, for example magnetic particles. Any of the
art-recognized methods can be used, for example, cross-linking reagents,
chemical derivatization methods, etc. to attach intact phage, phage ghosts
or phage proteins to microbeads or other capture agent. Alternatively,
antibodies or antibody fragments specific for the phage can be attached to
the surface of the microbead, and used to bind pathogens from a sample,
when phage has been added to the sample to bind the pathogen with high
binding specificity. As will be appreciated, other variations are also
possible, and are encompassed within the disclosed method of utilizing
phage for specific capture of pathogens.
In some instances, it may be desirable to test a biological sample in a
more invasive manner to test for intracellular pathogens or adherent
pathogens. Intracellular pathogens include such organisms as parasites
(e.g., Rickettsia, Chlamydia, Plasmodia), viruses (e.g., viral
genes or expression products), or aberrant proteins associated with a
pathological condition (e.g., prions). Adherent pathogens are pathogens
that bind strongly to host tissue, for example, using pili, and may not be
removed by washing. Such biological samples may be treated to generate a
cellular suspension, such as by homogenizing the tissue, or may even be
disrupted so that cellular contents are released. Intracellular pathogens
or pathogens present in cell suspensions may be captured and detected
using antibody or phage attached to microbeads. Alternatively, these
pathogens may be detected using a chemiluminescent agglutination assay, as
described in detail below.
Finally, once pathogens have been removed from the sample by phage or
antibody binding, the number of organisms present is determined by
measuring the luminescence in the presence of an oxidizable substrate
(e.g., luminol) and a source of peroxide. Preferred separation methods for
target pathogens include immuno-sedimentation using either magnetically
accumulated micro-beads or gravity sedimentation. Filtration of bacteria
or fungi from buffer solution can also be performed. Several methods for
isolation of pathogens from food and water have been published, e.g.,
Fratamico (1992) Food Microbiol. 9:105-113, and Pyle (1999) Appl.
Environm. Microbiol. 65:1966-1972). Use of these immuno-sedimentation
techniques provide several advantages over the aforementioned alternative
selective methods such as speed, simplicity, minimization of handling, and
elimination of the need for incubation equipment.
VI. Methods of Bacteriocin-Metal Complex Preparation
Bacteriocin-metal complexes are readily prepared in aqueous solution
(e.g., an aqueous buffer), although non-aqueous solvents and/or mixed
solvents can be used provided the metal salt and bacteriocin are
sufficiently soluble to form a chelated complex and bind to pathogens
present in or on the sample. If using a buffer, volatile buffers, such as
acetic acid, ammonium acetate, and ammonium bicarbonate are preferred.
Crystalline or powdered bacteriocin is dissolved to form a concentrated
solution, preferably greater than 0.5 M, and water soluble metal salts are
added to provide a slight molar excess over the bacteriocin. Chelates
formed in solution can be isolated by separating the free metal from the
bacteriocin. A preferred method of desalting the complex is dialysis or
gel filtration (e.g., dialysis in narrow-pore molecular weight cut-off
tubing for example, from Spectro-Por, or by gel filtration on GPC media
such as Sephadex G-25). The purified bacteriocin-metal complex can be
dried if desired, preferably by freeze drying or, alternatively, by spray
drying. Preferred methods for the preparation of particular bacteriocin-metal
complexes can be readily ascertained by those skilled in the art.
Bacteriocin-metal complexes isolated by the aforementioned procedures can,
optionally, be further characterized by combustion analysis, NMR, and
electronic spectroscopy, for example. These procedures should also be
accompanied by a bio-assay method to ensure preservation of bacterial
binding activity, and/or anti-microbial activity. A bio-assay can be
conducted as follows: Bacteria, diluted to a cell concentrations of 1-100
CFU/mL, preferably 10 CFU/mL, are treated with a bacteriocin-metal complex
(e.g., nisin-Co (II) complex (as described in example 1) at 0.1 to 1000 μg/mL,
preferably 1 to 100 μg/mL, and most preferably 30 μg/mL, at room
temperature for a time sufficient to achieve binding (usually 5 to 60
minutes). The cells are removed, by for example, centrifugation, magnetic
microbeads, or other method of pathogen capture, washed and resuspended in
assay solution. Chemiluminescence is measured after the addition of
oxidizable substrate and peroxide, (e.g., Luminol reagent purchased from
NEN Life Sciences (Boston, Mass.) and using a Luminator® luminometer). The
minimum number of cells that are detectable using the chemiluminescent
bacteriocin-metal complexes is approximately 10 to 100 cells per sample.
When a multimer of bacteriocins is utilized to form the bacteriocin-metal
complex, the bio-assay has even greater sensitivity.
Alternatively, an end-point determination for Minimum Inhibitory
Concentration (MIC) of the bacteriocin can be conducted according to
standard microbiological procedures. MIC is determined by testing the
ability of bacteria to grow in the presence of varying concentrations of
an agent to be tested for anti-microbial activity. One variation of this
procedure is performed as follows. Other variations of this general
protocol are of course within the ability of one skilled in the art. A
stock culture of ˜108 CFU/ml is used to inoculate a 5 ml
portion of Trypticase Soy Broth, using a 0.1 ml aliquot. An anti-microbial
agent is added to the inoculated samples, at concentrations ranging from
about 1 μg/ml to about 100 μg/ml, and the samples are grown for 24 hours
in a 37° C. incubator. The sample turbidities are compared with negative
controls containing no anti-microbial agent. The minimum concentration
yielding no bacterial growth is the MIC.
VII. Utility
A. Diagnostic and Analytical Assays
The bacteriocin-metal complexes can be used to detect the presence of any
analyte, provided antibodies with specificity for the analyte are
available. A general method for conducting a chemiluminescent
agglutination assay is as follows: (a) providing Staphylococcus aureus
cells with antibodies to an analyte bound thereto, (b) contacting a
sample with the Staphylococcus cells, (c) allowing the antibodies
to bind to the analyte and agglutinate the Staphylococcus cells,
(d) separating the agglutinated cells from the non-agglutinated cells, (e)
contacting the agglutinated cells with a bacteriocin and a transition or
lanthanide metal, (f) removing unbound complex and (g) detecting the
presence of the analyte by contacting the sample with a peroxide source
and an oxidizable substrate.
For example, intracellular pathogens or other analytes can be detected
using an agglutination assay utilizing antibodies specific for these
pathogens or analytes and Staphylococcus aureus cells. The S.
aureus cells bind the Fc portion of the antibody and, in the presence
of the antigen, in this case, the intracellular pathogen, become
aggregated. Agglutinated cells can be separated from non-aggregated cells
using filtration on narrow pore size membrane filters, which allow
non-aggregated cells to pass, while retaining aggregated cells. The cells
are then detected in situ on the filter by adding the bacteriocin-metal
complexes described herein. If desired, any unbound complex can be
removed, for example, by washing. The bacteriocin-metal complex, now bound
to the agglutinated S. aureus cells, can be detected using
chemiluminescence. By this procedure, pathogens other than gram-positive
and gram-negative bacteria and fungi can be tested and detected. This
procedure is most preferred for testing and detecting viruses and prions
or prion-like proteins. Food samples or food preparation surfaces can
conveniently be tested for the presence of these difficult to detect
pathogens. In the veterinary context, it would be very useful to screen
and detect diseases in animals (e.g., scrapie, Bovine Spongiform
Encephalopathy, hoof and mouth disease). The agglutination assay can of
course be used for any pathogen species, and is not limited to
intracellular pathogens. The agglutination assay is also very sensitive,
since in principle, as few as five pairs of agglutinated cells can be
detected.
In an assay for bacterial pathogens, the presence of pathogenic cells can
be detected using bacteriocin-metal complexes and measuring
chemiluminescence in the presence of an oxidizable substrate and a source
of peroxide. Specific pathogenic species can be detected by choosing the
bacteriocin targeted for a particular species, or by choosing a specific
capture reagent (e.g, antibody- or phage-mediated capture using magnetic
microbeads) in combination with a broad spectrum bacteriocin (e.g., nisin).
Assays for diseased animals can be performed in a few hours. For example,
bovine tuberculosis, caused by mycobacterial infection of cattle,
currently requires a sixteen week period for a diagnosis. Using the
present diagnostic methods, the presence of this disease can be determined
in a few hours, for example, using the following procedure: A fecal or
milk sample can be conveniently screened for the presence of mycobacteria
by filtering the milk or fecal matter (suspended in buffer, e.g.,
phosphate buffered saline) through a 5 μm filter, which captures the
clumps of waxy mycobacterial cells. Detection is then easily accomplished
by labeling with a bacteriocin-metal complex, for example, a nisin-Co
complex, and detecting chemiluminescence in the presence of an oxidizable
substrate and a source of peroxide. Alternatively, the mycobacterial cells
could be captured from the sample using a phage attached to microbeads
which is specific for mycobacteria, and then the cells could be detected
by labeling with a bacteriocin-metal complex and using chemiluminescence.
B. Diagnostic and Imaging Agents
The bacteriocin-metal complexes may be also used for diagnosis of disease.
Bacteriocins of varying specificity for their target pathogens can be used
for rapid identification of disease causing pathogens. A sample may be
removed from a patient and tested using bacteriocin-metal complexes
wherein the bacteriocin binds with specificity to a particular target
species. For example, a sample of lung aspirate from a patient suffering
from pneumonia can be tested using a battery of specific bacteriocin-metal
complexes to determine the causative pathogen within a matter of minutes,
instead of the usual hours required to grow the organism in culture for
identification purposes. Bacteriocin-metal complexes of predetermined
specificity for target organisms can be used distinguish between organisms
contributing to dental plaque or other infection for purposes of choosing
the appropriate treatment.
Diagnosis can also be accomplished via imaging of infected tissues using
the complexes. Bacteriocin-metal complexes can be used to diagnose the
pathogen present at sites of infections of the skin or mucosa. For
example, Streptococcus mutans is the species most commonly
associated with dental caries in humans. Bacteriocin-metal complexes can
be used to visualize sites of colonization or infection on the gums or on
an inflamed tooth by S. mutans. Tissue sections under microscopy
can be examined for local chemiluminescence produced by bacteriocin-metal
complexes binding to a site of infection. For example, mycobacteria can be
visualized in a tissue sample and used to diagnose the causative agent of
a disease condition.
Imaging can also be performed using the bacteriocin-metal complexes as
magnetic resonance imaging agents. Paramagnetic metals alter the magnetic
field in their vicinity such that paramagnetic metals can be easily imaged
within a patient's body using magnetic resonance imaging. By using a
paramagnetic metal in the bacteriocin-metal complexes, these metals can be
targeted to the location of a site of infection within the body of a
patient. Gadolinium is a preferred metal useful for magnetic resonance
imaging because of its extremely high nuclear spin, which produces a very
strong perturbation in the homogeneity of an applied magnetic field. For
imaging the presence of pathogenic bacteria, for example, the
Gd-bacteriocin chelated complex could be utilized with a bacteriocin
specific for a particular pathogen.
Alternatively, by forming the bacteriocin-metal complex with a radioactive
metal, preferably having a short half-life, the complex can be used as an
agent in a medical tracer for gamma scintillography. For example,
technicium 99, a short-lived radio-isotope, can be used in a bacteriocin-metal
complex as a medical tracer for gamma scintillography and used for medical
imaging, for example, a site of infection in a patient.
An imaging agent can also be prepared by cross-linking a bacteriocin to an
anti-tumor monoclonal antibody using a hetero-bifunctional reagent, such
as N-hydroxysuccinimide-activated N-propionylmaleimide. The malylated
peptide antibiotic would then react with a native sulfhydryl on the
antibody or a sulfhydryl introduced by treatment with a thiolating reagent
such as iminothiolane. Once the peptide is grafted onto the antibody
sidechain(s), a metal chelate of Gd or Tc, as discussed above, could be
formed and used for imaging a site of a tumor in a patient. Additional
heterobifunctional cross-linking agents are readily identified, for
example, by referring to catalogs of reagents (e.g., the Pierce Chemical
Co.).
C. Therapeutic Agents
The bacteriocin-metal complexes of the invention can be administered to a
mammalian subject, including a human, as a therapeutic agent to treat a
disease, condition or disorder that is known or hereinafter discovered to
be responsive to the bacteriocin of the complex. Thus, the present
invention encompasses methods for treating a patient who would benefit
from administration of a particular bacteriocin by administering a
therapeutically effective amount of a bacteriocin in the form of a metal-bacteriocin
complex as described earlier herein. By "treatment" of a disease,
condition or disorder is meant reduction in severity and/or frequency of
symptoms, elimination of symptoms and/or underlying cause, prevention of
the occurrence of symptoms and/or their underlying cause, and improvement
or remediation of damage. Thus, "treating" a patient involves prevention
of a particular disorder or adverse physiological event in a susceptible
individual as well as treatment of a clinically symptomatic individual by
inhibiting or causing regression of a disorder or disease. The
therapeutically effective amount administered is a nontoxic but sufficient
amount of the bacteriocin to provide the desired effect. As will be
appreciated, the amount of a particular bacteriocin that is "effective"
will vary from subject to subject, depending on the age, weight and
general condition of the individual, the severity of the pathology being
treated, the route of administration, the dosing regimen, the duration of
treatment desired or necessary, and other factors known to the prescribing
physician. Generally, a therapeutically effective amount is selected to
provide a daily dosage in the range of about 0.001 and 10 mg/kg of body
weight.
Accordingly, the invention includes pharmaceutical compositions
comprising, as an active ingredient, at least one of the complexes of the
invention in association with a pharmaceutical carrier or diluent. The
composition can be administered by oral, parenteral (intramuscular,
intraperitoneal, intravenous (IV) or subcutaneous) injection, transdermal
(either passively or using iontophoresis or electroporation), topical or
transmucosal (nasal, vaginal, rectal, or sublingual) routes of
administration, or using bioerodible inserts, and can be formulated in
dosage forms appropriate for each route of administration.
Particular bacteriocins with more or less specific binding to target
pathogens may be used as therapeutic agents. Preferred complexes are
comprised of nisin-cobalt complex, because of the low mammalian toxicity.
Complexes of bacteriocin with radioactive transition or lanthanide metal
(e.g., technicium (99Tc)) may be useful therapeutic agents, and
when attached to a monoclonal antibody or other delivery/carrier molecule
also have potential as targeted therapeutic agents. For example, a
bi-functional IgG molecule comprising an Fab fragment specific to a tumor
antigen and an Fab fragment directed against nisin could be formed. These
diagnostic and therapeutic uses have great promise in the fields of cancer
and AIDS treatment.
D. Binding of Bacteriocin-Metal Complex to Target Organisms
The methods of the present invention are suitable for use in rapidly
detecting gram positive bacteria and mycobacteria in samples as diverse as
drinking water, hamburger and blood. The methods are also suitable for
detecting gram negative bacteria, which have generally been permeabilized,
although permeabilization is not always necessary, and for fungi when the
fungal cell wall has been disrupted. For drinking water and low protein
solutions, samples may be concentrated using thin film type-membranes so
that captured bacterial cells can be resuspended in a smaller volume for
easier analysis. More concentrated samples such as biological fluids and
foodstuffs lend themselves to processing with rapid isolation techniques
such as immuno-magnetic micro-beads, or high density immuno-silica
micro-beads. Especially useful are micro-beads with covalently attached
bacteriophage for targeting particular species of bacteria.
A core utility of the bacteriocin-metal complexes of the present invention
is the binding activity specifically to viable bacteria. A preferred
embodiment is a simple binding assay comprising labeling gram positive
cells in suspension, pelleting the cells by centrifugation or isolating
the cells by filtration or immuno-separation, washing unbound label, and
detecting the bound complexes with chemiluminescent reagents. Bacterial
cells are diluted from stock cultures and the cell suspensions are labeled
at room temperature with a bacteriocin-metal complex at a concentration
sufficient to achieve labeling. Generally a concentration of bacteriocin-metal
complex of about 0.01 to 0.05 mg/mL is sufficient. The labeled cells can,
optionally, be collected by centrifugation, filtration on micro-porous
filters of the polycarbonate film type (Osmonics, Inc.) or rapid immuno-separation
using antibody coated super para-magnetic particles. Phage coated
paramagnetic particles may also be used. The labeled cells are then washed
and resuspended in peptone water for assay with preferably, hydrogen
peroxide/luminol or any number of oxidizable chemiluminescent substrates,
including lucigenin, penicillin and the like.
Potential bacterial targets for the bacteriocin-metal complex of the
present invention include, but are not limited to, pneumococci,
streptococci, staphylococci, aerobic bacilli, anaerobic clostridia,
listeria, nocardia, Bacillus anthracis (anthrax), Clostridial
species (e.g. C. botulinum and C. perfringes whose exotoxins
cause botulism and tetanus, respectively), mycobacterium tuberculosis,
mycobacterium avium, mycobacterium paratuberculosis, mycobacterium bovis
and mycobacterium leprae.
Claim 1 of 14 Claims
1. An isolated chelated
complex comprising:
nisin, fusion proteins thereof, and mixtures thereof; and
a detectable label comprising cobalt chelated with the nisin.
____________________________________________
If you want to learn more
about this patent, please go directly to the U.S.
Patent and Trademark Office Web site to access the full
patent.
|